(data stored in ACNUC7421 zone)

EMBL: CP000438.PE508

CP000438.PE508       Location/Qualifiers
FT   CDS             complement(563308..563601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15455"
FT                   /db_xref="GOA:A0A0H2ZLH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH5"
FT                   /protein_id="ABJ15455.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWGAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH"
     MGTEGFFDGL GEMLGRAIRF VVDLLSGLLG GIWGAMDDFL HGLARAIGMD ASLFSFVFLV        60
     LGLLLLYSGI RAFMRRSIVG GVIWTVLGLI VMSWLIH                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page