(data stored in ACNUC7421 zone)

EMBL: CP000438.PE51

CP000438.PE51        Location/Qualifiers
FT   CDS             complement(61430..63091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15007"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK06"
FT                   /protein_id="ABJ15007.1"
FT                   /translation="MRYARHASRYSLFTLAVSAALLPGAGWAANGDLAGARKPPSVACS
FT                   WNREAALSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFAKRLCAADG
FT                   RTPVTSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLYWTRLYMTRTL
FT                   RQWAPSFRLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGT
FT                   PGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASVTISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADSALPNYVLPLG
FT                   SVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQFSKASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVMNAMPDPSLVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNNYYTGVPASGGGARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
     MRYARHASRY SLFTLAVSAA LLPGAGWAAN GDLAGARKPP SVACSWNREA ALSYEERRLD        60
     TPLPFSGANV VTHDQTPLAE RIVKGAGFDG FEPAFAKRLC AADGRTPVTS YAKALKLVTE       120
     EGRALWRAAV DRAQGRRAIP AGALPASDDR MLYWTRLYMT RTLRQWAPSF RLGKAQAQAL       180
     QWRFERASRG QLDIDLPRRY AADGSRYRRM IISGFDVFTL GTPGTANTGL RNGNPSGATA       240
     LALDGREFRL ADGSLLRIEA YLLPVSYDPF NRGMQEDTLG PWFRPGPRRV DASVTISQGG       300
     ANQFWLEAWN GRFHGSSAGN DGIVYCPADS ALPNYVLPLG SVTNPGTAPI SLRGSGCNIN       360
     PPRRWLGYDS ASRWRQNLPA QFSKASLPVR QLLAADTWRG IERPPGATSQ AAEGFDVTWH       420
     TNYDFFPDCA NPRTENVPTN GVMNAMPDPS LVLPPNRRIC ARNGGGGDYL SNESAYRNTV       480
     LRDAFRLEIP AGHIHVPVMN NYYTGVPASG GGARNDNAIS DARYEAYRSA IVAQTRALLV       540
     GVGNALAQGA QAD                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page