(data stored in ACNUC7421 zone)

EMBL: CP000438.PE510

CP000438.PE510       Location/Qualifiers
FT   CDS             564699..565457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06420"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15457"
FT                   /db_xref="GOA:A0A0H2ZKC5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC5"
FT                   /protein_id="ABJ15457.1"
FT                   /translation="MTEVDFNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQ
FT                   GLSLQHVKPHGALYMHLARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVASTRARLEGAGIRIKAPR"
     MTEVDFNSDM GEGFGPWTIG DGVDAAIMPL ISSANIATGF HAGDPSSMRR TVEMAAEHGV        60
     AIGAHPGFRD LVGFGRRHIA APAIELVNDM LYQLGALREF ARLQGLSLQH VKPHGALYMH       120
     LARDEAAARL FVETLQRLEP ELLLYCMPGS ATWRIGRELG QPLVREFYAD RDYDRSGSIV       180
     FTRRVAALDP QQVADKVLRA CREGKVRTVE GEDLDIAFDS VCIHSDTPGA LELVASTRAR       240
     LEGAGIRIKA PR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page