(data stored in ACNUC7421 zone)

EMBL: CP000438.PE537

CP000438.PE537       Location/Qualifiers
FT   CDS             591645..591902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15484"
FT                   /db_xref="GOA:A0A0H2ZKR8"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR8"
FT                   /protein_id="ABJ15484.1"
FT                   /translation="MRTLTLCWLALLALAVAGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
     MRTLTLCWLA LLALAVAGVL LGGAGDSPWL LAAVLACAVA KGWLIGERFM ELAHAPALWR        60
     RLLLAWPLLM ALAVGAALYL ARMNN                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page