(data stored in ACNUC7421 zone)

EMBL: CP000438.PE54

CP000438.PE54        Location/Qualifiers
FT   CDS             complement(66550..66978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15010"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIZ5"
FT                   /protein_id="ABJ15010.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
     MDLRPSHVHV FPPSRDLPAA TSPHRETLLR SGCAWNGSLY LGYPLGQPQL TVQRLSLAAH        60
     ERLDWQVHPM PSALYVLKGE LRLETRDGAQ STRVLEGEAA GCLMNIIHRL IAGAEPVEAL       120
     LFHAGVEGMP VGLGERGEMP DA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page