(data stored in ACNUC7421 zone)

EMBL: CP000438.PE541

CP000438.PE541       Location/Qualifiers
FT   CDS             complement(595676..595870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15488"
FT                   /db_xref="GOA:A0A0H2ZLK8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK8"
FT                   /protein_id="ABJ15488.1"
FT                   /translation="MRQCLYCLHETEGAESACEQCGMPLPSASQRQLQGRRQRRFAWFC
FT                   VGLALFCLGMMLWLPRDVP"
     MRQCLYCLHE TEGAESACEQ CGMPLPSASQ RQLQGRRQRR FAWFCVGLAL FCLGMMLWLP        60
     RDVP                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page