(data stored in ACNUC7421 zone)

EMBL: CP000438.PE545

CP000438.PE545       Location/Qualifiers
FT   CDS             598668..598904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL60"
FT                   /protein_id="ABJ15492.1"
FT                   /translation="MSDYLITLSQSGRLLASMTVSAARFAEVRELMRQRFPAGDGFELR
FT                   IETRRESRRLLEQGPQGVRLLAVEYMTEELKDG"
     MSDYLITLSQ SGRLLASMTV SAARFAEVRE LMRQRFPAGD GFELRIETRR ESRRLLEQGP        60
     QGVRLLAVEY MTEELKDG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page