(data stored in ACNUC7421 zone)

EMBL: CP000438.PE548

CP000438.PE548       Location/Qualifiers
FT   CDS             complement(600869..601375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF9"
FT                   /protein_id="ABJ15495.1"
FT                   /translation="MPARPDRARVTIALAVLVHLHRETIAEAPLPWRYRKQCPGGKPRR
FT                   RAGREATPPLGPEVVDASTRLALHEKKAPSPCMSDAMSKNKHPDLGEIQRSLNQALEGY
FT                   DCQCRMHYDGTVSINVAAREHDETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWL
FT                   GKHAA"
     MPARPDRARV TIALAVLVHL HRETIAEAPL PWRYRKQCPG GKPRRRAGRE ATPPLGPEVV        60
     DASTRLALHE KKAPSPCMSD AMSKNKHPDL GEIQRSLNQA LEGYDCQCRM HYDGTVSINV       120
     AAREHDETFT FVGIQPGELD NPTRLHLFAE SLRRDLALLE PWLGKHAA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page