(data stored in ACNUC7421 zone)

EMBL: CP000438.PE553

CP000438.PE553       Location/Qualifiers
FT   CDS             complement(606248..606856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06990"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15500"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG2"
FT                   /protein_id="ABJ15500.1"
FT                   /translation="MPRFLRNALLPVLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQR
FT                   RADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQGEL
FT                   SSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRIAVARGRYVKSVQEYNVLLRQFP
FT                   GVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
     MPRFLRNALL PVLALLLSGC GYNAMQAGDE QVKAAWSEVL NQYQRRADLV PNLVSTVKGY        60
     ASHEASVLTQ VTEARAKVGS VQLNADQLDD EQAVQRFQKA QGELSSALSR LLVVTENYPQ       120
     LKADGLFKDL LTQLEGTENR IAVARGRYVK SVQEYNVLLR QFPGVITAKL FGYKPKANFS       180
     VENEAAISTA PKVDFGNPQP AQ                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page