(data stored in ACNUC7421 zone)

EMBL: CP000438.PE555

CP000438.PE555       Location/Qualifiers
FT   CDS             607682..608512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07010"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15502"
FT                   /db_xref="GOA:A0A0H2ZLF7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF7"
FT                   /protein_id="ABJ15502.1"
FT                   /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAILL
FT                   LPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FGGEQLSGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDGNAL
FT                   KRWPLALDYLVWLTLLSGLPFPLIAAGARTRAFARFWALEWKLGLAVGVCVLASYGLVL
FT                   WAMQLGSIAEAAALRETSVLLAVLFGMRFLNEPFGLPRLLACGLVLAGMLLMKL"
     MLATSLVLCA AVLHATWNTL VKFSSDRLLV VACMDVVGVL CAILLLPFVS LPPAEVWPWL        60
     LGATVLQLLY RVLLIEAYKV GDLGLVYPLM RGLSPLVVLG LTLAFGGEQL SGRQILGILL       120
     IPFGMLCLLW GGGGSRLPWR TLPVVLLIGL CIGGYTWSDG NALKRWPLAL DYLVWLTLLS       180
     GLPFPLIAAG ARTRAFARFW ALEWKLGLAV GVCVLASYGL VLWAMQLGSI AEAAALRETS       240
     VLLAVLFGMR FLNEPFGLPR LLACGLVLAG MLLMKL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page