(data stored in ACNUC7421 zone)

EMBL: CP000438.PE556

CP000438.PE556       Location/Qualifiers
FT   CDS             608582..608968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07020"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15503"
FT                   /db_xref="GOA:A0A0H2ZL70"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL70"
FT                   /protein_id="ABJ15503.1"
FT                   /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFLGSLE
FT                   GFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYLAD
FT                   WGPLRSLVWFVGMLLIAAFFVVSA"
     MTIAFWCVLI AIFLPYVCTS IAKFGGEGYG GRANADPRAF LGSLEGFRRR ANNAQLNAFE        60
     VTPAFAAAVI IAHLVGNASQ ATLDSLAIAW ITSRLLYVIC YLADWGPLRS LVWFVGMLLI       120
     AAFFVVSA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page