(data stored in ACNUC7421 zone)

EMBL: CP000438.PE56

CP000438.PE56        Location/Qualifiers
FT   CDS             complement(67774..68280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15012"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX7"
FT                   /protein_id="ABJ15012.1"
FT                   /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDAR
FT                   LAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEGIR
FT                   EEQLDGAEERNVTLKVRGQEISFNGRDFLFGFALPNFFFHVTTAYAILRHNGVELGKMD
FT                   FLGGA"
     MSLSIYQASI PTFLRTLGNL SAILKKAAAH AEAKNIDPRI FIDARLAPDM FPLARQVQIA        60
     SDAAKGAGAR LAGLEVPSYA DTETTFDELQ ARIARTVEFL EGIREEQLDG AEERNVTLKV       120
     RGQEISFNGR DFLFGFALPN FFFHVTTAYA ILRHNGVELG KMDFLGGA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page