(data stored in ACNUC7421 zone)

EMBL: CP000438.PE560

CP000438.PE560       Location/Qualifiers
FT   CDS             complement(611373..612116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15507"
FT                   /db_xref="GOA:A0A0H2ZLG2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG2"
FT                   /protein_id="ABJ15507.1"
FT                   /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWAR
FT                   ETFADSEIVYVAGNHEFYSSEMTDLTQAMRNIARALDIHFLENDEARIGPARFLGATLW
FT                   TDFQLYGADGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHRASRDWLAEQLARPH
FT                   DGPTLVVSHHAPSALSIPPQFVGNPLSPAFASNLDELLAQADYWLHGHVHDALDYRIGR
FT                   ARVLANPGGYPHERGGFRPEFVFEV"
     MKIRLLSDLH HEHFDGRRQL PEVEADVVVL AGDIHSHLEG LHWARETFAD SEIVYVAGNH        60
     EFYSSEMTDL TQAMRNIARA LDIHFLENDE ARIGPARFLG ATLWTDFQLY GADGYAPAHE       120
     LALQSMPDFS CIDWFGGDFT PEQSIALHRA SRDWLAEQLA RPHDGPTLVV SHHAPSALSI       180
     PPQFVGNPLS PAFASNLDEL LAQADYWLHG HVHDALDYRI GRARVLANPG GYPHERGGFR       240
     PEFVFEV                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page