(data stored in ACNUC7421 zone)

EMBL: CP000438.PE565

CP000438.PE565       Location/Qualifiers
FT   CDS             618132..619196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG9"
FT                   /protein_id="ABJ15512.1"
FT                   /translation="MHTLYWRDLESPANGEWLGLAVQVEGAHRAPSFLHLQSGGQARIR
FT                   LMRGDQPLLWATQLPYHDGIWLVKSLVAASPAQASVPPIDSPTLEALRGLRGEARYKAW
FT                   SRYFVEALRASPGSCLEAGRWLLRLSLAEQAPAWQPPQSHDSRERVLERWRYRSVGRDA
FT                   LLPDWRFYSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREGELPP
FT                   VLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERVLQSLA
FT                   QRVDAPVRRGRRPLDSEQLNQVLLRLFDDRPWPRVLTRARAVLKEEQWCAEVRDWLTAR
FT                   ERLDALEPIIRRVE"
     MHTLYWRDLE SPANGEWLGL AVQVEGAHRA PSFLHLQSGG QARIRLMRGD QPLLWATQLP        60
     YHDGIWLVKS LVAASPAQAS VPPIDSPTLE ALRGLRGEAR YKAWSRYFVE ALRASPGSCL       120
     EAGRWLLRLS LAEQAPAWQP PQSHDSRERV LERWRYRSVG RDALLPDWRF YSLEKVLDDD       180
     WVQWLDWWGR DNDALIALRR VEDDEGRVKW WRKKAREGEL PPVLALRLNC LDACVILDGH       240
     CRLRAGLLEN VAPEILVLCA YDEQPMPVDT AQRERVLQSL AQRVDAPVRR GRRPLDSEQL       300
     NQVLLRLFDD RPWPRVLTRA RAVLKEEQWC AEVRDWLTAR ERLDALEPII RRVE             354
//

If you have problems or comments...

PBIL Back to PBIL home page