(data stored in ACNUC7421 zone)

EMBL: CP000438.PE572

CP000438.PE572       Location/Qualifiers
FT   CDS             624443..624925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH2"
FT                   /protein_id="ABJ15519.1"
FT                   /translation="MRRWLLTLPFLLLAGCAGLHAPSRDVEEAASPSVARDPADPQDCL
FT                   ARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRRLETPPAPQRSTWPALRIQLAEPVNGR
FT                   FEFESPCLRKSGKGCRYSQATLLKVYRSYLVGKPCSLLSPRAVKRCVDPATTAARR"
     MRRWLLTLPF LLLAGCAGLH APSRDVEEAA SPSVARDPAD PQDCLARSDC TTKTSRTLLF        60
     VFDYAEAGGE LVVRDGRRLE TPPAPQRSTW PALRIQLAEP VNGRFEFESP CLRKSGKGCR       120
     YSQATLLKVY RSYLVGKPCS LLSPRAVKRC VDPATTAARR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page