(data stored in ACNUC7421 zone)

EMBL: CP000438.PE574

CP000438.PE574       Location/Qualifiers
FT   CDS             625582..626349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15520"
FT                   /db_xref="GOA:A0A0H2ZL84"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL84"
FT                   /protein_id="ABJ15520.1"
FT                   /translation="MSSVHSAAQQGFSAEAQRYAQGRPEYPEALSDWLRDALGLRPQTV
FT                   AVDLGAGTGKFTRLLARTGARVVAVEPVDAMRAQLAEALPQVQALAGSAQSIPLANGFA
FT                   DALVCAQAFHWFATVEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYEGDA
FT                   PRFYKGDWRRPFERAPFGPLRLSTFAYEHVGPPEQVIVSRFLSVSFIAALPETEKNAVA
FT                   AQLRELVASHPALKGKEQVALPYRTEAYLAEAR"
     MSSVHSAAQQ GFSAEAQRYA QGRPEYPEAL SDWLRDALGL RPQTVAVDLG AGTGKFTRLL        60
     ARTGARVVAV EPVDAMRAQL AEALPQVQAL AGSAQSIPLA NGFADALVCA QAFHWFATVE       120
     ALEEMRRVLT AEGRLGLVWN VRDESLDWVA EITRIITPYE GDAPRFYKGD WRRPFERAPF       180
     GPLRLSTFAY EHVGPPEQVI VSRFLSVSFI AALPETEKNA VAAQLRELVA SHPALKGKEQ       240
     VALPYRTEAY LAEAR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page