(data stored in ACNUC7421 zone)

EMBL: CP000438.PE577

CP000438.PE577       Location/Qualifiers
FT   CDS             628151..629305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15524"
FT                   /db_xref="GOA:A0A0H2ZLH9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH9"
FT                   /protein_id="ABJ15524.1"
FT                   /translation="MGSASQRSVQDLYEDVGDHYRIFIRAPFFQLLKHRDYWVPLLYFF
FT                   FVLITMFWDLYCHSGQYLYEARSLLPFYLFPFLIAALRIGDIVVDTRCRNVENLGGFER
FT                   SAESSRYVQLSLYERQWFRLRYRAYGGNLRCLAGDLVENWRLWKEVNSKAAKDIDGAVM
FT                   LRFFLPPRDLARLVTLLAALIAVIATLIITLGADRQGYFEFVDNLPAYLKLYWGVVFII
FT                   AFSGPYMIFLGMQARLVLRAMIDALSISQPSDKLFYQFIQRLIWADGVKPANPSANSRV
FT                   LRAVDSMVDFFYEEWRSAIGKLVLWLVALLVLLLCTLLHCLLRVFSSARTLGEALMRIL
FT                   LAVLGGVCWIVAAIQRLNLAVPFHWTFFVLTGTGALFATLCGQP"
     MGSASQRSVQ DLYEDVGDHY RIFIRAPFFQ LLKHRDYWVP LLYFFFVLIT MFWDLYCHSG        60
     QYLYEARSLL PFYLFPFLIA ALRIGDIVVD TRCRNVENLG GFERSAESSR YVQLSLYERQ       120
     WFRLRYRAYG GNLRCLAGDL VENWRLWKEV NSKAAKDIDG AVMLRFFLPP RDLARLVTLL       180
     AALIAVIATL IITLGADRQG YFEFVDNLPA YLKLYWGVVF IIAFSGPYMI FLGMQARLVL       240
     RAMIDALSIS QPSDKLFYQF IQRLIWADGV KPANPSANSR VLRAVDSMVD FFYEEWRSAI       300
     GKLVLWLVAL LVLLLCTLLH CLLRVFSSAR TLGEALMRIL LAVLGGVCWI VAAIQRLNLA       360
     VPFHWTFFVL TGTGALFATL CGQP                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page