(data stored in ACNUC7421 zone)

EMBL: CP000438.PE579

CP000438.PE579       Location/Qualifiers
FT   CDS             complement(630110..630463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15526"
FT                   /db_xref="GOA:A0A0H2ZLQ2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLQ2"
FT                   /protein_id="ABJ15526.1"
FT                   /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGLI
FT                   SEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDSDA
FT                   GQNQYGQNPKGIA"
     MEWFLKCVKE HYFDFNGRAR RKEYWMFTLV NIIISVALSV VLGLISEKLL PIANLYSLAV        60
     LLPALGVTAR RLHDINKSGW WMLIALIPIV GLYLIYLLAK DSDAGQNQYG QNPKGIA          117
//

If you have problems or comments...

PBIL Back to PBIL home page