(data stored in ACNUC7421 zone)

EMBL: CP000438.PE581

CP000438.PE581       Location/Qualifiers
FT   CDS             631670..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15643"
FT                   /db_xref="GOA:A0A0H2ZLH8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH8"
FT                   /protein_id="ABJ15643.1"
FT                   /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDAK
FT                   TRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLRAL
FT                   EAYDQFKK"
     MLNNWTEFVP AVKKAFGALG KQHPKMLAAY GALEEASAEG ALDAKTRELI SIAVAITTRC        60
     DGCIGVHTEA ALKAGASEAE IAQTLATAIS LNAGAAYVYS LRALEAYDQF KK               112
//

If you have problems or comments...

PBIL Back to PBIL home page