(data stored in ACNUC7421 zone)

EMBL: CP000438.PE582

CP000438.PE582       Location/Qualifiers
FT   CDS             complement(631998..632513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15528"
FT                   /db_xref="GOA:A0A0H2ZKI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI0"
FT                   /protein_id="ABJ15528.1"
FT                   /translation="MSDLPPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPMALADGVD
FT                   LVYLSQGLALLPLGTGLVGLLAGFLLHVRGRWLGALLALLPATLICAWNLYNYAAHGDE
FT                   ALSPSFAQYTQALLGLLLLGGVLSLVDLLHGRPSTLLRKGLLGLGWLALVAWLGLLFYL
FT                   QRLYGLTF"
     MSDLPPRPAF WPYLPGYALL LLSVLLCASG SYRFVTPMAL ADGVDLVYLS QGLALLPLGT        60
     GLVGLLAGFL LHVRGRWLGA LLALLPATLI CAWNLYNYAA HGDEALSPSF AQYTQALLGL       120
     LLLGGVLSLV DLLHGRPSTL LRKGLLGLGW LALVAWLGLL FYLQRLYGLT F                171
//

If you have problems or comments...

PBIL Back to PBIL home page