(data stored in ACNUC7421 zone)

EMBL: CP000438.PE583

CP000438.PE583       Location/Qualifiers
FT   CDS             632701..632859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15529"
FT                   /db_xref="GOA:A0A0H2ZLI4"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLI4"
FT                   /protein_id="ABJ15529.1"
FT                   /translation="MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
     MDLIRILIAI LLPPLGVFLQ VGFGGAFWLN ILLTLLGYIP GIVHAVYIIA KR                52
//

If you have problems or comments...

PBIL Back to PBIL home page