(data stored in ACNUC7421 zone)

EMBL: CP000438.PE584

CP000438.PE584       Location/Qualifiers
FT   CDS             complement(632869..633327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL94"
FT                   /protein_id="ABJ15530.1"
FT                   /translation="MELIRNLDDANMGEVYWRLYRRYISLFIENEADDAYAWRCARALD
FT                   ELDDAVVERLCAASLRYRAARLERLGESAEEVAPARGVLERIEPGELIVPDPEQGDEAV
FT                   IHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTVKEPWNYA"
     MELIRNLDDA NMGEVYWRLY RRYISLFIEN EADDAYAWRC ARALDELDDA VVERLCAASL        60
     RYRAARLERL GESAEEVAPA RGVLERIEPG ELIVPDPEQG DEAVIHLSLN CEWDREHGME       120
     WIVRGGEVLY VGPFHGEDPW RDFTVKEPWN YA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page