(data stored in ACNUC7421 zone)

EMBL: CP000438.PE586

CP000438.PE586       Location/Qualifiers
FT   CDS             complement(633827..634174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15532"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV9"
FT                   /protein_id="ABJ15532.1"
FT                   /translation="MKPELDALEAWLGQPLPAAFVAALEQHGGRLVEPGLLLYAADELL
FT                   ERNRAFETSLYCPGYLAIGDDSGGRAVVMALDDHRQALFLVDHGAMTPDCFEPLAPSLE
FT                   AWLEAGPCLPE"
     MKPELDALEA WLGQPLPAAF VAALEQHGGR LVEPGLLLYA ADELLERNRA FETSLYCPGY        60
     LAIGDDSGGR AVVMALDDHR QALFLVDHGA MTPDCFEPLA PSLEAWLEAG PCLPE            115
//

If you have problems or comments...

PBIL Back to PBIL home page