(data stored in ACNUC7421 zone)

EMBL: CP000438.PE587

CP000438.PE587       Location/Qualifiers
FT   CDS             complement(634164..634778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15533"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI3"
FT                   /protein_id="ABJ15533.1"
FT                   /translation="MTDRLPCRACGHLILPTTAARNDGLCMPCKGGYRQNIEDGKRFHT
FT                   ERRRYLASPQALYWSALVSRVYDGREGFAGLSPAERSYYAVSVLSGEVHNGGFDQYFGN
FT                   SSGDQYQAARAGLRELEAEDALALLERAAALLFGDAPVPVSQAERQLRMPTWADQPDRD
FT                   CEAALNALDTRFYALADALGERLLAHARHHALFALDEPDEA"
     MTDRLPCRAC GHLILPTTAA RNDGLCMPCK GGYRQNIEDG KRFHTERRRY LASPQALYWS        60
     ALVSRVYDGR EGFAGLSPAE RSYYAVSVLS GEVHNGGFDQ YFGNSSGDQY QAARAGLREL       120
     EAEDALALLE RAAALLFGDA PVPVSQAERQ LRMPTWADQP DRDCEAALNA LDTRFYALAD       180
     ALGERLLAHA RHHALFALDE PDEA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page