(data stored in ACNUC7421 zone)

EMBL: CP000438.PE588

CP000438.PE588       Location/Qualifiers
FT   CDS             complement(634969..637740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15534"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR040711"
FT                   /db_xref="InterPro:IPR041549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ2"
FT                   /protein_id="ABJ15534.1"
FT                   /translation="MSLSTTAFPSLQGENMSRSPIPRHRALLAGFCLAGALSAQAATQE
FT                   EILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMW
FT                   VLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGANAAHAPLLKRAVQ
FT                   WLVNGDPGAATAKDFKVSVVGVDKTATLNGLKSAGLQPADAACNALTDASCASTSKLLV
FT                   LGNGASAASLSATVRARLQAGLPILFVHTNGWNQSSTGQQILAGLGLQEGPYGGNYWDK
FT                   DTVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYDWSKCTSYVGRTTCDDVPGLS
FT                   DFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPMDKAADTARF
FT                   QETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRM
FT                   AAPGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVA
FT                   LVSPYGGLLQLVYSGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKA
FT                   DWLEIRSGSVEVHAKVEKVRGSIDKDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAK
FT                   TPAIQQECAVRGWDCDSETLHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGE
FT                   SHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDDTRVNYRNAYNLIV
FT                   AGRAEADPLAGVYKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYL
FT                   HQRQVDKSDWDASKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFAL
FT                   WGIRTSAAAQAQVAAYSFAEQPAFFYANNRTNEYSTVKLLDMSQGSPTWPFP"
     MSLSTTAFPS LQGENMSRSP IPRHRALLAG FCLAGALSAQ AATQEEILDA ALVSGDSSQL        60
     TDSHLVALRL QQQVERIRQT RTQLLDGLYQ NLSQAYDPGA ASMWVLPANP DNTLPFLIGD       120
     KGRVLASLSL EAGGRGLAYG TNVLTQLSGA NAAHAPLLKR AVQWLVNGDP GAATAKDFKV       180
     SVVGVDKTAT LNGLKSAGLQ PADAACNALT DASCASTSKL LVLGNGASAA SLSATVRARL       240
     QAGLPILFVH TNGWNQSSTG QQILAGLGLQ EGPYGGNYWD KDTVPSSRTR TRSVELGGAY       300
     GQDPALVQQI VDGSWRTDYD WSKCTSYVGR TTCDDVPGLS DFSKRVDVLK GALDAYNQKA       360
     QNLFALPGTT SLRLWLLWAD AVRQNIRYPM DKAADTARFQ ETFVADAIVG YVREAGAAQK       420
     ELGSYAGQRQ QSMPVSGSEE TLTLTLPSAQ GFTAIGRMAA PGKRLSIRIE DAGQASLAVG       480
     LNTQRIGSTR LWNTRQYDRP RFLKSPDIKL QANQSVALVS PYGGLLQLVY SGATPGQTVT       540
     VKVTGAASQP FLDIQPGEDS SQAIADFIQA LDADKADWLE IRSGSVEVHA KVEKVRGSID       600
     KDYGGDVQRF IRELNEVFID DAYTLAGFAI PNQAKTPAIQ QECAVRGWDC DSETLHKLPG       660
     TQHINVDQYA QCGGGCSGNP YDQTWGLNPR GWGESHELGH NLQVNRLKVY GGRSGEISNQ       720
     IFPLHKDWRV LREFGQNLDD TRVNYRNAYN LIVAGRAEAD PLAGVYKRLW EDPGTYALNG       780
     ERMAFYTQWV HYWADLKNDP LQGWDIWTLL YLHQRQVDKS DWDASKAALG YGTYAQRPGN       840
     SGDASSTDGN DNLLLGLSWL TQRDQRPTFA LWGIRTSAAA QAQVAAYSFA EQPAFFYANN       900
     RTNEYSTVKL LDMSQGSPTW PFP                                               923
//

If you have problems or comments...

PBIL Back to PBIL home page