(data stored in ACNUC7421 zone)

EMBL: CP000438.PE589

CP000438.PE589       Location/Qualifiers
FT   CDS             complement(638309..638644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15535"
FT                   /db_xref="GOA:A0A0H2ZL99"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL99"
FT                   /protein_id="ABJ15535.1"
FT                   /translation="MDYSPIVAQVWGMLTWFIPAALLIGLLKSPWAKGQIGELLVRLFA
FT                   HWQLDRQTYRRLHNVTLNTPDGTTQIDHVFFSPYGIFVLETAGFQHLPIGLYRCTGEPC
FT                   CRSQALA"
     MDYSPIVAQV WGMLTWFIPA ALLIGLLKSP WAKGQIGELL VRLFAHWQLD RQTYRRLHNV        60
     TLNTPDGTTQ IDHVFFSPYG IFVLETAGFQ HLPIGLYRCT GEPCCRSQAL A                111
//

If you have problems or comments...

PBIL Back to PBIL home page