(data stored in ACNUC7421 zone)

EMBL: CP000438.PE59

CP000438.PE59        Location/Qualifiers
FT   CDS             70324..71028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00700"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15015"
FT                   /db_xref="GOA:A0A0H2ZJP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP1"
FT                   /protein_id="ABJ15015.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEA
FT                   LDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLAGGSGALGG
FT                   AAAPLCRIDGCA"
     MNDLTLHYLY DPLCGWCYGA SPLLAAAREV TGLDVRLHGG GMMTDANRQP VGAGLRHYVM        60
     PHDLRIAQLT GQPFGKDYFD GLLRDTSAVF DSAPPTAAVL AAEALDGLGA AMLARIQRAH       120
     YVEGRRIAER PVLLELGAEL GLGEGFAEAF DACSGEPLRA HFADSRRLMN RLGAAGFPTF       180
     ALERDGRLQV LDTGRYLGQP DDWRAFLETQ LRLAGGSGAL GGAAAPLCRI DGCA             234
//

If you have problems or comments...

PBIL Back to PBIL home page