(data stored in ACNUC7421 zone)

EMBL: CP000438.PE590

CP000438.PE590       Location/Qualifiers
FT   CDS             complement(638737..639858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15536"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLR2"
FT                   /protein_id="ABJ15536.1"
FT                   /translation="MNDPLWIWQQPDWPQFNWQAEALAPLLRSCSQAQGRLLGMLGAVG
FT                   SDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAELL
FT                   LDATHAHQEPLDEQRLFTWHSWLFPTDDQLLARPLHIGALRGEEPMQVVSGRIDRPTVY
FT                   FEAPPRAGLEAQLADFLAWFESSRSDASLDPFLRAGIAHFWFVTLHPFDDGNGRLTRAI
FT                   TDLALAQGEQQAIRFYAMSASILDDRAGYYRILEASQKGGLDITKWLQWFLETLLKSLE
FT                   QALARIDRVLVKARFWQAHRSQTLSAEQIKVLNRLLDGGERGFEDGISAAQYQAVAKVS
FT                   KATATRHLSDLLEKGCIERLPGGGRSTRYQIAR"
     MNDPLWIWQQ PDWPQFNWQA EALAPLLRSC SQAQGRLLGM LGAVGSDTEV QSSLDAMLQN        60
     IVTSSAIEGE QLNVGSVRSS LARRLGLHEE GRTTSRSEGL AELLLDATHA HQEPLDEQRL       120
     FTWHSWLFPT DDQLLARPLH IGALRGEEPM QVVSGRIDRP TVYFEAPPRA GLEAQLADFL       180
     AWFESSRSDA SLDPFLRAGI AHFWFVTLHP FDDGNGRLTR AITDLALAQG EQQAIRFYAM       240
     SASILDDRAG YYRILEASQK GGLDITKWLQ WFLETLLKSL EQALARIDRV LVKARFWQAH       300
     RSQTLSAEQI KVLNRLLDGG ERGFEDGISA AQYQAVAKVS KATATRHLSD LLEKGCIERL       360
     PGGGRSTRYQ IAR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page