(data stored in ACNUC7421 zone)

EMBL: CP000438.PE593

CP000438.PE593       Location/Qualifiers
FT   CDS             complement(643347..647084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15539"
FT                   /db_xref="GOA:A0A0H2ZLJ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ7"
FT                   /protein_id="ABJ15539.1"
FT                   /translation="MQRLQAVLLLCLACCWPGLAGALTLTPEERAWLAEHPSIRLGVDT
FT                   SWPPFEFRDEQGRYQGLAAGYVSLLQERLGVSLTPVEPKTWTQVLEQAKDGRLDLLPGI
FT                   MATPERQEYLSFTRPYLDFPIIILARKNGPMPKRIDELYGLKVAVVDHYAPHELLIAQH
FT                   PDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLNGLEISGETPYRYQLAM
FT                   AVPRGQPILAGIVDKVLADLSAEEIERLQAPWVGGLLDRRPAWREMATYGLPIVLLILV
FT                   SVAILLAMNRRLRREVSRRRQLERELRDSEQHYRGLVESLNAIAWEMRLEENRFTYVSP
FT                   HAERLLGYPLGEWLQPGFWQRTLHPMDAEYAIHYCMSESQAGRDHSFDYRMLAADGRVV
FT                   WIRDLVTPIAQGRDLLLRGLMIDITEAKLTEQAMRLSEQKFASVFHHCPDMVVLANGAD
FT                   GRFLAVNNTFEQQIGIAADDAIGKTATELGIWALPGLGPQVLEKLGHGNLTNLEVPLRR
FT                   RNGSTFSALLSAQHVALDQTPALVVVIRDITHLVETQELLRISEEKFANAFHAYPDGLL
FT                   ISRLEDGTLIDVNEGFTRLTGYRRDEVISRSTLELGLWVDTEDRKRLISLVRHHTLTQG
FT                   FTAPVRDRNGGIRQCEMSAHRISIDGEDCVLTIARDITERQLMQEKLQQAATVFESTAE
FT                   GVMITDTRQRITAVNRAFSEITGYSEQEALGRSPSLLSSGQHDSSFYLAMWNQLERDGH
FT                   WQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLKYAQARLDYQAHHDP
FT                   LTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAE
FT                   RLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQAEGHEFFVSA
FT                   SVGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRR
FT                   ALERDELQLYYQPKLSLESGLLVGAEALVRWYHPLFGEISPERFIPLAEDCGLILPLGD
FT                   WVLGHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIERLEQLLEQSGLEPSRLQLEI
FT                   TESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGL
FT                   PDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAEL
FT                   FASKFLKPRQPIGAPREAPV"
     MQRLQAVLLL CLACCWPGLA GALTLTPEER AWLAEHPSIR LGVDTSWPPF EFRDEQGRYQ        60
     GLAAGYVSLL QERLGVSLTP VEPKTWTQVL EQAKDGRLDL LPGIMATPER QEYLSFTRPY       120
     LDFPIIILAR KNGPMPKRID ELYGLKVAVV DHYAPHELLI AQHPDLTLLP LPSVAAALQA       180
     LATGQADAFV GDFASSVWNL RQLKLNGLEI SGETPYRYQL AMAVPRGQPI LAGIVDKVLA       240
     DLSAEEIERL QAPWVGGLLD RRPAWREMAT YGLPIVLLIL VSVAILLAMN RRLRREVSRR       300
     RQLERELRDS EQHYRGLVES LNAIAWEMRL EENRFTYVSP HAERLLGYPL GEWLQPGFWQ       360
     RTLHPMDAEY AIHYCMSESQ AGRDHSFDYR MLAADGRVVW IRDLVTPIAQ GRDLLLRGLM       420
     IDITEAKLTE QAMRLSEQKF ASVFHHCPDM VVLANGADGR FLAVNNTFEQ QIGIAADDAI       480
     GKTATELGIW ALPGLGPQVL EKLGHGNLTN LEVPLRRRNG STFSALLSAQ HVALDQTPAL       540
     VVVIRDITHL VETQELLRIS EEKFANAFHA YPDGLLISRL EDGTLIDVNE GFTRLTGYRR       600
     DEVISRSTLE LGLWVDTEDR KRLISLVRHH TLTQGFTAPV RDRNGGIRQC EMSAHRISID       660
     GEDCVLTIAR DITERQLMQE KLQQAATVFE STAEGVMITD TRQRITAVNR AFSEITGYSE       720
     QEALGRSPSL LSSGQHDSSF YLAMWNQLER DGHWQGEIWN RRKTGELYPE WLTISAVHNP       780
     QGEITHFVGV FADISTLKYA QARLDYQAHH DPLTGLPNRL LFESRLNHAL DEAREESRPG       840
     AVLFIDLDRF KHINDSLGHP IGDLLLKAIA ERLRDQLRDV DTVARLGGDE FIILLPGLHQ       900
     ESDAEHVARK LLNAFTAPFQ AEGHEFFVSA SVGIALFPKD GDDAPTLVKN ADAAMYRAKS       960
     RGRSRIEYYT RELTYLATER MALETELRRA LERDELQLYY QPKLSLESGL LVGAEALVRW      1020
     YHPLFGEISP ERFIPLAEDC GLILPLGDWV LGHACQQMGE WQKLHAPFGP LSVNLAGAQL      1080
     GQPQLIERLE QLLEQSGLEP SRLQLEITES FIMNQTEEAL AVLHGLKRLG VQLAIDDFGT      1140
     GYSSLSYLKR LPLDILKIDK SFIRGLPDDP HDAAITRAII ALGRSMQLTV IAEGVETEGQ      1200
     QSFLTHEGCE QIQGFVLSPP LPAELFASKF LKPRQPIGAP REAPV                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page