(data stored in ACNUC7421 zone)

EMBL: CP000438.PE596

CP000438.PE596       Location/Qualifiers
FT   CDS             complement(651201..651650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15542"
FT                   /db_xref="GOA:A0A0H2ZKW8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW8"
FT                   /protein_id="ABJ15542.1"
FT                   /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIEV
FT                   DDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEINALI
FT                   ERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
     MSEIKSRLLD AVKVAMRAQD KPRLTTLRLA LADIKRVEVD ERIEVDDARA LLILDRMIKQ        60
     RRDAQRQFSD AGRQDLAEVE AAEILVLQDF MPKPLDDHEI NALIERSIVD SGAQGPQDMG       120
     KAMNLLRPQV QGRVDMAQVS QRLKARLSS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page