(data stored in ACNUC7421 zone)

EMBL: CP000438.PE599

CP000438.PE599       Location/Qualifiers
FT   CDS             complement(653240..653809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07580"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15545"
FT                   /db_xref="GOA:Q02TI2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI2"
FT                   /protein_id="ABJ15545.1"
FT                   /translation="MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLR
FT                   VAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKG
FT                   VATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPM
FT                   TVLTGLIVWRHRANLRDLFAGRERHF"
     MVWLLAILAY LLGSLSFAVL LSRWFGTQDP RASGSGNPGA TNMLRVAGKK LAILTLLGDV        60
     GKGLLPVLVA RWLGLGVMEE AWVGIAAVIG HLYPLYFNFR GGKGVATAAG MLLGLYPPAV       120
     LLAAAAWLLT FKLSRTSSLA SLVATPLTLP LLAWQQPGAL LPMTVLTGLI VWRHRANLRD       180
     LFAGRERHF                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page