(data stored in ACNUC7421 zone)

EMBL: CP000438.PE603

CP000438.PE603       Location/Qualifiers
FT   CDS             complement(656028..656534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15549"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB0"
FT                   /protein_id="ABJ15549.1"
FT                   /translation="MRLFAIVLLCLVLATCASHIPSARVTHPASAGLPGLQGFQLMPPE
FT                   QAVDALPYRNRYPLINAELRQGLAAHGYHESATPQFRVYYWLALRDAPLEFRPDLPPTS
FT                   GMGPYLAIHRLRDETGTLRVRLVDLEERVLWEGMVSTGLSPARANPEQLELVVGALLRQ
FT                   LPRAR"
     MRLFAIVLLC LVLATCASHI PSARVTHPAS AGLPGLQGFQ LMPPEQAVDA LPYRNRYPLI        60
     NAELRQGLAA HGYHESATPQ FRVYYWLALR DAPLEFRPDL PPTSGMGPYL AIHRLRDETG       120
     TLRVRLVDLE ERVLWEGMVS TGLSPARANP EQLELVVGAL LRQLPRAR                    168
//

If you have problems or comments...

PBIL Back to PBIL home page