(data stored in ACNUC7421 zone)

EMBL: CP000438.PE605

CP000438.PE605       Location/Qualifiers
FT   CDS             complement(658179..659450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15551"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH6"
FT                   /protein_id="ABJ15551.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSITD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGKAS
FT                   NSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTVRAGISNDGNPSRIN
FT                   IVRTLRSAHARRIALSGGSRAKLRAALKELERIKREEPDNLGDIQELELEIAKLRARID
FT                   RVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YEKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHEWNIYAA
FT                   QASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITPREHQALWFEYERVREAFEDSFA
FT                   QQQIVSASDIYPVFRELFQRRLVA"
     MSYVIDRRLN GKNKSTVNRQ RFLRRYREHI KKAVEEAVSR RSITDMEHGE QISIPGRDID        60
     EPVLHHGRGG RQTVVHPGNK EFTAGEHIAR PSGGGGGRGG GKASNSGEGM DDFVFQITQE       120
     EFLDFMFEDL ELPNLVKRHI TGTDTFKTVR AGISNDGNPS RINIVRTLRS AHARRIALSG       180
     GSRAKLRAAL KELERIKREE PDNLGDIQEL ELEIAKLRAR IDRVPFLDTF DLKYNLLVKQ       240
     PNPTSKAVMF CLMDVSGSMT QATKDIAKRF FILLYLFLKR NYEKIEVVFI RHHTSAREVD       300
     EEEFFYSRET GGTIVSSALK MMQEIMAERY PTHEWNIYAA QASDGDNWND DSPVCRDILL       360
     KQIMPFVQYY TYVEITPREH QALWFEYERV REAFEDSFAQ QQIVSASDIY PVFRELFQRR       420
     LVA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page