(data stored in ACNUC7421 zone)

EMBL: CP000438.PE61

CP000438.PE61        Location/Qualifiers
FT   CDS             71678..71911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15017"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY2"
FT                   /protein_id="ABJ15017.1"
FT                   /translation="MKTIGLGIATLLFSATALAAPKPCEELKAEIETKIQSAGVTSYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
     MKTIGLGIAT LLFSATALAA PKPCEELKAE IETKIQSAGV TSYTLEIVRN DEVSDPNMVV        60
     GSCENGTKKI IYQKNDD                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page