(data stored in ACNUC7421 zone)

EMBL: CP000438.PE617

CP000438.PE617       Location/Qualifiers
FT   CDS             complement(671923..672984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15563"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL6"
FT                   /protein_id="ABJ15563.1"
FT                   /translation="MPAFSLLPKPSALLPLLLAAAFLPPAFVQAEEEAAKDQPPAPVER
FT                   PAVSERSQDEAKGLERQLPEDGQQILKAGDESFLTLWLPANTAEAEGVVILVPGDGESP
FT                   DWPQAIGPLRRKLPDAGWQTLSLALPDPQSTAPVTRPAESAASASADKDASAADSASKP
FT                   DVKGESGNAPAPESTAEAGSGEPAQSEDQAPPPAIDPVEQRKAHAERVMARLQASIDLA
FT                   LQHEPKSVVLLGHGTGAYWAARYLAEKEPAEIHNLLLVAAEVPRDFRPALEDMVPKLKL
FT                   ATGDFYYRDARADREAARLRMQAGKRQKHPAYVQIAMQALPADPKAEQEQLYRRIRGWL
FT                   SLHLQADAQKPAE"
     MPAFSLLPKP SALLPLLLAA AFLPPAFVQA EEEAAKDQPP APVERPAVSE RSQDEAKGLE        60
     RQLPEDGQQI LKAGDESFLT LWLPANTAEA EGVVILVPGD GESPDWPQAI GPLRRKLPDA       120
     GWQTLSLALP DPQSTAPVTR PAESAASASA DKDASAADSA SKPDVKGESG NAPAPESTAE       180
     AGSGEPAQSE DQAPPPAIDP VEQRKAHAER VMARLQASID LALQHEPKSV VLLGHGTGAY       240
     WAARYLAEKE PAEIHNLLLV AAEVPRDFRP ALEDMVPKLK LATGDFYYRD ARADREAARL       300
     RMQAGKRQKH PAYVQIAMQA LPADPKAEQE QLYRRIRGWL SLHLQADAQK PAE              353
//

If you have problems or comments...

PBIL Back to PBIL home page