(data stored in ACNUC7421 zone)

EMBL: CP000438.PE618

CP000438.PE618       Location/Qualifiers
FT   CDS             673136..675529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07820"
FT                   /product="putative histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15564"
FT                   /db_xref="GOA:A0A0H2ZLB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB8"
FT                   /protein_id="ABJ15564.1"
FT                   /translation="MLRRCCLLFFCLLLSLPVRAEESVALPLTAELRTWLAEHRELRVG
FT                   VVTEAPYAQYDRRLQQYSGANVELMGWLATAMQVTLRWQGYPDQAALDDALRAGRVDIA
FT                   PGLSQTPAGLRLWLFSDPYLRVSRLVVGKRDGSGSVELEQLERDTRVAVRAGSSVADYL
FT                   SSTYSSLQWVSADSEREVLRAVLAGQARYAVIDEAQLSRLTREPEFAELAVVGDIGYPQ
FT                   LLRVATRRDWPELAMVVDQALRSLPRKSLDQLHERWLQPKYPRLGESPGFWQNLSILLG
FT                   LLLAGALAAVFLQRRQQHALEARLYGARRDLELRQAAEEALRLTQFSIDNSTLGILWVN
FT                   WDSRVRYANRAAEQMLGHADGQLVDRPLADFEPGLDMDRWLNLWRRARNSEEGPLSFET
FT                   RCLRADGSWLPADVSLSFLRFGTSEYLVVFLSDVTERRRAREALQESEARMKGIASNVP
FT                   GMVFRLERPRAGAFSDFAYISEGSEALVGYSALELIESGRGIRGLVHPDDRERYWSSQM
FT                   AALDENRDWHWQGRILTRQGELRWADIKASARCFEDGRAVWDGVVWDITANKQIELELG
FT                   ESRAQLRELSAHLESVREEEKARIAREVHDELGQVLTVLKLETSMCELAYADAQEGLRE
FT                   RLGNMKKLIAQLFQLVRDVATALRPPILDAGIGSAVEWQARRFEARTQIPCLVEVPENS
FT                   PQLVDAKAIGLFRILQEALTNVMRHAEAHTVQLRLLREGDELCLSVSDDGRGFDVATVG
FT                   RGSSFGLVGMRERVLMMGGTLDIDSAPGEGTTLSVRIPLGVASP"
     MLRRCCLLFF CLLLSLPVRA EESVALPLTA ELRTWLAEHR ELRVGVVTEA PYAQYDRRLQ        60
     QYSGANVELM GWLATAMQVT LRWQGYPDQA ALDDALRAGR VDIAPGLSQT PAGLRLWLFS       120
     DPYLRVSRLV VGKRDGSGSV ELEQLERDTR VAVRAGSSVA DYLSSTYSSL QWVSADSERE       180
     VLRAVLAGQA RYAVIDEAQL SRLTREPEFA ELAVVGDIGY PQLLRVATRR DWPELAMVVD       240
     QALRSLPRKS LDQLHERWLQ PKYPRLGESP GFWQNLSILL GLLLAGALAA VFLQRRQQHA       300
     LEARLYGARR DLELRQAAEE ALRLTQFSID NSTLGILWVN WDSRVRYANR AAEQMLGHAD       360
     GQLVDRPLAD FEPGLDMDRW LNLWRRARNS EEGPLSFETR CLRADGSWLP ADVSLSFLRF       420
     GTSEYLVVFL SDVTERRRAR EALQESEARM KGIASNVPGM VFRLERPRAG AFSDFAYISE       480
     GSEALVGYSA LELIESGRGI RGLVHPDDRE RYWSSQMAAL DENRDWHWQG RILTRQGELR       540
     WADIKASARC FEDGRAVWDG VVWDITANKQ IELELGESRA QLRELSAHLE SVREEEKARI       600
     AREVHDELGQ VLTVLKLETS MCELAYADAQ EGLRERLGNM KKLIAQLFQL VRDVATALRP       660
     PILDAGIGSA VEWQARRFEA RTQIPCLVEV PENSPQLVDA KAIGLFRILQ EALTNVMRHA       720
     EAHTVQLRLL REGDELCLSV SDDGRGFDVA TVGRGSSFGL VGMRERVLMM GGTLDIDSAP       780
     GEGTTLSVRI PLGVASP                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page