(data stored in ACNUC7421 zone)

EMBL: CP000438.PE62

CP000438.PE62        Location/Qualifiers
FT   CDS             complement(71923..72360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK13"
FT                   /protein_id="ABJ15018.1"
FT                   /translation="MRPLTRLVPLALLLLAGCAGPLPQPDPQMAWVELRSAPANTLLAE
FT                   RLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDGFE
FT                   AGRRYRLEVRPQLRRALALLSDERGEVVARSNFQTSRCPPY"
     MRPLTRLVPL ALLLLAGCAG PLPQPDPQMA WVELRSAPAN TLLAERLDGE RLSDGRYFQV        60
     TPGRHVLEVR FQYELYGGSG GGGGGFGEPV QINCYQQVVY DGFEAGRRYR LEVRPQLRRA       120
     LALLSDERGE VVARSNFQTS RCPPY                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page