(data stored in ACNUC7421 zone)

EMBL: CP000438.PE620

CP000438.PE620       Location/Qualifiers
FT   CDS             676336..677370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07850"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15566"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY3"
FT                   /protein_id="ABJ15566.1"
FT                   /translation="MLPAMRTGLLCALLGVTAPAWAEYVTVISFGGANKEAQETAFYKP
FT                   FKSATGNRVVHGSYNGDLAKLKRMVEISHVSWDVVEVEAPELARGCEEGLFEKLDMAKV
FT                   GDPADFVPGAVQPCGVGIFVWTTLLAYNPGKVAGSPQGWADFWDVKKFPGKRGLRWGAK
FT                   YSLEFALMADGVAPKDVYQTLATPAGVERAFRKLDELKPYIHWWKSGQDPVRDLADGTV
FT                   VMSSAYNGRIAAAQAEKQPLAMVWSGGVYDFDFWALPVGVWKKQLAEEFIRFASQPEQQ
FT                   KAFAENIAYGPANRKAVGLLDPQVAASLPTAPQNMQNAVGMNVAFWAEHGEALEQRFQN
FT                   WAKR"
     MLPAMRTGLL CALLGVTAPA WAEYVTVISF GGANKEAQET AFYKPFKSAT GNRVVHGSYN        60
     GDLAKLKRMV EISHVSWDVV EVEAPELARG CEEGLFEKLD MAKVGDPADF VPGAVQPCGV       120
     GIFVWTTLLA YNPGKVAGSP QGWADFWDVK KFPGKRGLRW GAKYSLEFAL MADGVAPKDV       180
     YQTLATPAGV ERAFRKLDEL KPYIHWWKSG QDPVRDLADG TVVMSSAYNG RIAAAQAEKQ       240
     PLAMVWSGGV YDFDFWALPV GVWKKQLAEE FIRFASQPEQ QKAFAENIAY GPANRKAVGL       300
     LDPQVAASLP TAPQNMQNAV GMNVAFWAEH GEALEQRFQN WAKR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page