(data stored in ACNUC7421 zone)

EMBL: CP000438.PE622

CP000438.PE622       Location/Qualifiers
FT   CDS             678769..679815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07870"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15568"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLM1"
FT                   /protein_id="ABJ15568.1"
FT                   /translation="MSKSLKAASLKFATLAAGLACAAQAMAVDLTVVSFGGANKSAQIK
FT                   AFYEPYQKATGNRIVAGEYNGEMAKVKAMVDTNSVSWDLVEVESPELSRGCDEGLFEEL
FT                   DPAQFGKTEDFVPGAIQPCGVGFFVWSTVLAYNADKLKSAPTSWADFWDIKKFPGKRGL
FT                   RKGAKYTLEFALMADGVAPKDVYGVLATKEGQDRAFKKLDEIKSSIQWWEAGAQPPQYL
FT                   ASGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKKQEETLKFIAFSVQ
FT                   PQQQKTYSENIAYGPANKQAVPLLDKALLKDMPTTPENIQNQVAMDVTFWADYGEQLEQ
FT                   RFNAWAAR"
     MSKSLKAASL KFATLAAGLA CAAQAMAVDL TVVSFGGANK SAQIKAFYEP YQKATGNRIV        60
     AGEYNGEMAK VKAMVDTNSV SWDLVEVESP ELSRGCDEGL FEELDPAQFG KTEDFVPGAI       120
     QPCGVGFFVW STVLAYNADK LKSAPTSWAD FWDIKKFPGK RGLRKGAKYT LEFALMADGV       180
     APKDVYGVLA TKEGQDRAFK KLDEIKSSIQ WWEAGAQPPQ YLASGDVVMS SAYNGRIAAV       240
     QKESNLKVVW NGGIYDFDAW AIPKGAKKQE ETLKFIAFSV QPQQQKTYSE NIAYGPANKQ       300
     AVPLLDKALL KDMPTTPENI QNQVAMDVTF WADYGEQLEQ RFNAWAAR                    348
//

If you have problems or comments...

PBIL Back to PBIL home page