(data stored in ACNUC7421 zone)

EMBL: CP000438.PE631

CP000438.PE631       Location/Qualifiers
FT   CDS             687357..687716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL1"
FT                   /protein_id="ABJ15577.1"
FT                   /translation="MIKAIDEMLKLWAEEMHAPGSNGGGYAGGNLIAMLIASKGEVVRG
FT                   HRGSRVILDRVAEVDRLVNRLPEELKNVVVEHYLNRDSFPEQKYRHCGCSRNTFYLRLH
FT                   VAHQGIQDGLLRRVA"
     MIKAIDEMLK LWAEEMHAPG SNGGGYAGGN LIAMLIASKG EVVRGHRGSR VILDRVAEVD        60
     RLVNRLPEEL KNVVVEHYLN RDSFPEQKYR HCGCSRNTFY LRLHVAHQGI QDGLLRRVA        119
//

If you have problems or comments...

PBIL Back to PBIL home page