(data stored in ACNUC7421 zone)

EMBL: CP000438.PE633

CP000438.PE633       Location/Qualifiers
FT   CDS             688551..689066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15579"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD2"
FT                   /protein_id="ABJ15579.1"
FT                   /translation="MPEQAVTLEALYAAIEQVLRERLPEAQLIGFWPGVPENTPAVSLE
FT                   IAELLPERDPGTGESALLCRLQARIMVPPGADRQAVSIACGIVRTLREQTWNLSLEPAR
FT                   FVRSAVDGSREELKSLRVWLVEWTQSLRLGDPEWAWEDQPPGSLMLGFDPQTGPGHEPD
FT                   YFAPEALA"
     MPEQAVTLEA LYAAIEQVLR ERLPEAQLIG FWPGVPENTP AVSLEIAELL PERDPGTGES        60
     ALLCRLQARI MVPPGADRQA VSIACGIVRT LREQTWNLSL EPARFVRSAV DGSREELKSL       120
     RVWLVEWTQS LRLGDPEWAW EDQPPGSLML GFDPQTGPGH EPDYFAPEAL A                171
//

If you have problems or comments...

PBIL Back to PBIL home page