(data stored in ACNUC7421 zone)

EMBL: CP000438.PE636

CP000438.PE636       Location/Qualifiers
FT   CDS             690096..690983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08030"
FT                   /product="putative phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15582"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL5"
FT                   /protein_id="ABJ15582.1"
FT                   /translation="MIIDLSQLPEPEVIENLDFETIYQELLGDFREAMAGEWTAEVESD
FT                   PVLKLLQLAAYRELLLRARINDAARAVMLAYASGADLDQIGAGFNVQRLLIRPAQPEAV
FT                   PPVEAQYESDKSLRNRIQLAFEQLSVAGPRNAYIAHALGADGRVADASATSPAPCEVLI
FT                   SVLGVEGNGQAPEAVLQAVRLALNAEDVRPVADRVTVRSAGIVPYQVKAQLYLFPGPEA
FT                   ELIRAAAEASLRDYISAQRRLGRDIRRSALFATLHVEGVQRVELQEPAADVVLDETQAA
FT                   YCTGYAITLGGVDE"
     MIIDLSQLPE PEVIENLDFE TIYQELLGDF REAMAGEWTA EVESDPVLKL LQLAAYRELL        60
     LRARINDAAR AVMLAYASGA DLDQIGAGFN VQRLLIRPAQ PEAVPPVEAQ YESDKSLRNR       120
     IQLAFEQLSV AGPRNAYIAH ALGADGRVAD ASATSPAPCE VLISVLGVEG NGQAPEAVLQ       180
     AVRLALNAED VRPVADRVTV RSAGIVPYQV KAQLYLFPGP EAELIRAAAE ASLRDYISAQ       240
     RRLGRDIRRS ALFATLHVEG VQRVELQEPA ADVVLDETQA AYCTGYAITL GGVDE            295
//

If you have problems or comments...

PBIL Back to PBIL home page