(data stored in ACNUC7421 zone)

EMBL: CP000438.PE65

CP000438.PE65        Location/Qualifiers
FT   CDS             complement(74060..75043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15021"
FT                   /db_xref="GOA:A0A0H2ZJ05"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ05"
FT                   /protein_id="ABJ15021.1"
FT                   /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVSL
FT                   GIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRQLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
     MTDNPFATPT APVQPPAREV PATTQPYAFI AVLALVTCLS FAVSLGIQWY NDIGEIRQRF        60
     SEHLQLMAPH WFTGLVFYAA ANLLVLHAYR EKRQLVEFRP LALLLIGYGL LNLVCGMLAG       120
     IGLAPLTLPF YQWVTAQSSY GVWLMAFNEA MSWVYLLLGS LLPLGLVLLG SRVNSPRLAE       180
     GEEARVAAWQ VALGAALCFA TLCFKLMQFL PYALLRYDEP WLYGLYLSGV ALPAALLFGA       240
     VCTRLPARLQ RFAAGRALLL AVVAMLLWSV ALLAVGGGLA LLMILGLAPA GIGYTLLVAL       300
     LGVGLLALLW PIGRLATRWC YADQLAA                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page