(data stored in ACNUC7421 zone)

EMBL: CP000438.PE69

CP000438.PE69        Location/Qualifiers
FT   CDS             78396..78671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00800"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15025"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ0"
FT                   /protein_id="ABJ15025.1"
FT                   /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
     MSPAITRKRF IAGAVCPACS EQDKIQMWEE DGVPHRECVA CGYADTLNAQ GQSIPKELGT        60
     RVNQNAPKPA NPKVQSVQFF PNPKLKKKPD A                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page