(data stored in ACNUC7421 zone)

EMBL: CP000438.PE71

CP000438.PE71        Location/Qualifiers
FT   CDS             complement(80049..80963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15027"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ5"
FT                   /protein_id="ABJ15027.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYATDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENINNYTQAYEKDLQQVGVPR
FT                   TEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASRGQ
FT                   GMIQEVCNSPDMGDWAPPSCAKA"
     MSQPSENRLI TSARYALCLL TASGVLLSGC ASSGVGSVAQ TTRAEYYPSC YEPVSHLRST        60
     DNAVRNSAIT GAITGGLLGG LAGGLASDEN RGRNAALAAA GGALAGGAAG YYMEKQKQIS       120
     DDRARIGSYA TDVDRSTVEI NRSVAYAKSA QSCYQSQFKA LLDGRKNKSI NEAEGRKRLA       180
     EIVSGLQETN ALLVAANGRA GENINNYTQA YEKDLQQVGV PRTEVTKVAE AENRASTTKG       240
     GSKPKTGSNP KVPKEAVATE QTIRKAQDAQ SEGNKVASRG QGMIQEVCNS PDMGDWAPPS       300
     CAKA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page