(data stored in ACNUC7421 zone)

EMBL: CP000438.PE72

CP000438.PE72        Location/Qualifiers
FT   CDS             complement(81025..82737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15028"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK19"
FT                   /protein_id="ABJ15028.1"
FT                   /translation="MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPGG
FT                   MAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGIGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
     MFEKAILPLA LGACLAFAAP AWAEGDSPDN PKPLADDVAL PLPCGGEMVF RHVYVLAEGA        60
     LDDREVNLGY AFNEGEAGYQ QSFISGYRRD YVNGQFSLAD LAPAWQQKLS ASLPKPAAGT       120
     PLKPMLYFIG KYEVTARQYA AVMSQAAALS GQGEAPACDV PGGMAARLPK VDLSRFDAER       180
     FGAVYSAWLL KNHPDLLPVS GRGKNPEDGG IGFVRLPTEV EWEFAARGGQ AVSRQELEGR       240
     LFPRKVEGSD QEGPLGDWAV YNQVAGGTGQ AARLLPVGMK RPNPLGLFDV IGNAAEMVQE       300
     SFQLVHAGRR QGTYGGFVVK GGNYLEGEMT LFTGMRREYP LFAADGSEQR NETTGFRVAI       360
     GALSAPRSRY PELFAQWQKE GRLAALTDAI DDAQDPTKQL DGIIAATRDP QMQAQLAQIN       420
     EELKRNVSLI ARQREEAAGN LIQSAALVAE TINNYNIRLT NLKKDREKAV AARDQATAQL       480
     YAGAIANGRS ALDGALAIYI DNLATGTRYT DAVIQAQFQR IQEELNRNPV LGKSLVKRAT       540
     LFVKHVGDYR QQHRAEPEAV LKELLASSGR                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page