(data stored in ACNUC7421 zone)

EMBL: CP000438.PE77

CP000438.PE77        Location/Qualifiers
FT   CDS             complement(88489..89169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15032"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK01"
FT                   /protein_id="ABJ15032.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGGEAVAGVVMPSIDRVGRYFPLTVACLLPANADLGGL
FT                   VGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAV
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
     MNSVGFYGKL AGRGDFVSRG LPNTFVEPWD AWLASGMRAS QDELGAAWLD AYLTSPLWRF        60
     AIAPGLLGGE AVAGVVMPSI DRVGRYFPLT VACLLPANAD LGGLVGGDDG WFEQVESLLL       120
     STLEPEAEVE AFEQAVAQLP APPCGPRIEQ SLISGNLLRS EAVTPAQRLA ALAQHACDGA       180
     SHWWGRGSAR ISAGLMRYQG LPPAPAFGRF LTGEGEVIPL FPGIPG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page