(data stored in ACNUC7421 zone)

EMBL: CP000438.PE78

CP000438.PE78        Location/Qualifiers
FT   CDS             complement(89166..92474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15033"
FT                   /db_xref="GOA:A0A0H2ZK24"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK24"
FT                   /protein_id="ABJ15033.1"
FT                   /translation="MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
FT                   RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAV
FT                   LLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERA
FT                   AHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALD
FT                   DGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGE
FT                   FLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRS
FT                   YFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQS
FT                   YIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLG
FT                   EESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKA
FT                   WISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQR
FT                   VYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTA
FT                   SLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNV
FT                   TQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSL
FT                   VGQEEEEGAREQPQQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVS
FT                   AMAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQL
FT                   NAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGVMDSYFRQYLQPYVDT
FT                   SASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAVRFELKPVTMDAAIS
FT                   QFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFR
FT                   LLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL"
     MQSLAEVSAP DAASVATAEE LATLKQRMDE ALALLKRAKL GGSERRNLYE LPWYVIIGPP        60
     GSGKTTALMN SGLDFPLAAQ MGAGAIRGVG GTRNCDWWFT DEAVLLDTAG RYTTQDSHAQ       120
     VDKAAWLGFL DLLKTQRKRR PIDGAFIAIS LSDLLLGSDA ERAAHAQAIR ARIQELYQQL       180
     GVRFPIYVML TKFDLVPGFM EFFDSLNREE RAQVWGMTFA LDDGKSAEGP LAVFDSEFAL       240
     LEQRLTARLV ERLQQERDPA RRDLVYGFPQ QFAALRECLG EFLNGVFKPN PYEERPLLRG       300
     LYFTSGTQEG SPIDRLIGSM AQSMNLDRQH LARQTGTGRS YFIERLFREV AFGERGLVGT       360
     NPKVERRRKW LTIGALSATA LVVLAVTAVW IASYRANQSY IAAVDQRVDP LARGIESLSP       420
     AQRDVLAVLP QLNAVQNLAG DAPSWAEGYG LYQGDMLGEE SASVYRKLLI AVFAPRLVTR       480
     IEEQLRSGGS SDFLYEGLKA YLMLGSPDHY DADFIKAWIS LDWERNLPRD LSPEQRQALH       540
     AHLDALLERR PPSARLDQDL VEDLRRQLQQ LPVAQRVYDR VKRQRLPKDV PDFRISDAAG       600
     RDAPLVFARK SGKPLTDPLS GFFTYRGYRE VFLTASLSQA GTIAEEQWVL GRDLNDAGDA       660
     ANLALDVRRL YFQDYLRQWD DLLADLTVVP ITNVTQAADV LRILSGPTSP FRKLLEAVAR       720
     ETDLQKGDRL VAAQVKKAAD GTVDKLKQRL GSLVGQEEEE GAREQPQQAD SDPISAHFAE       780
     LNSLVSKGEG GNEPAPIDSL LEDMNALYVQ VSAMAGASGD SLLGDAKNQV AAAASRVALS       840
     AERQPPVVQG LVKNVVNSTT SSMMGSVRNQ LNAAWISDVV SVYRQSLAGR YPIAAGSSRD       900
     ATLEDFGHFF GAGGVMDSYF RQYLQPYVDT SASTWRWQPG AAQKLGINPG VLHTFQRAAA       960
     IRDAFFRSGG MQPAVRFELK PVTMDAAISQ FILDLDGQQL TYDHGPARPV AMQWPSANGL      1020
     GVVRLTVTPP PSSGRSGLTL EGPWAWFRLL DQSDLERGNS PDRFTLRLRI DGSSIACELR      1080
     ASSAFNPFKS RVVSGFSLPE RL                                               1102
//

If you have problems or comments...

PBIL Back to PBIL home page