(data stored in ACNUC7421 zone)

EMBL: CP000438.PE79

CP000438.PE79        Location/Qualifiers
FT   CDS             complement(92696..94045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15641"
FT                   /db_xref="GOA:A0A0H2ZKR2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR2"
FT                   /protein_id="ABJ15641.1"
FT                   /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGD
FT                   PYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTR
FT                   GEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKR
FT                   IHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
     MPPIDDPFGT PAGGGNGSPP DDRTMIMPRP GGRAPEPAGG PRGGDPYTPP PMASLAPLSG        60
     RGDGLNPLEQ AAGPLLAMLT RLRNTIAHPA PASLRAQLLG YLRQFEEKAR QAGVAPDEVM       120
     LARYVLCTAL DEAVLSTPWG STSDWGKQSL LITLHNEAWG GEKVFQLLEH CLQNPHQRLH       180
     LLELLYLCTS LGFEGRYRVM HDGRSQLEAL RERTAAVIRS TRGEYEHELS PHWRGLSVMR       240
     DRLSQYLPPW VGIAIGLALL LALLFGLRMK LAADAEPVFK RIHAIGEIPV QAIDRPAVQP       300
     RVIERPRLAR FLADDIKAQR VAVEDAVDRS VVTIRGDELF ASASASVRDE FQPLLLRIAD       360
     ALRKVKGQVL VTGHSDNRPI ATLRYPSNWK LSQARAQEVA DLLGATTGDA GRFTAEGRSD       420
     TEPVATNASA EGRARNRRVE ITVFAEGAQ                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page