(data stored in ACNUC7421 zone)

EMBL: CP000438.PE80

CP000438.PE80        Location/Qualifiers
FT   CDS             complement(94052..95386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15034"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK83"
FT                   /protein_id="ABJ15034.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLI
FT                   DNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
     MSWNNRVVWS EGMFLRPQHF QQHDRYLETL VDGRCRSLLA GGWGFSELKL DDALLTQGKL        60
     AIVSARGVLP DGTPFNIPAD DPAPAPLNVE ESLRDGIVYL GLPLKRVGTR DTVEEGEALG       120
     GARYVSQVQE VRDDNAAFES RAPVALGSQA FRLLTERDGL GEYAAVGVAR VREKRADQAL       180
     SLDEDYLPPV LDIAAAPPLA SFAKELLGLL HQRGEALAGR VVASSAGGAS EIADFLLLQL       240
     VNRAEALTGH LSRVRPLHPQ ELYRELVALA GEFCTFTASQ RRPEEYPVYN HDDLAASFAP       300
     VMLALRQALA TVIDAKAIAI PIVEKAYGVH VAMLSDRSLI DNASFVLVVR ADVPGESLRG       360
     HFPQQAKVGS VEHIRDLVNL QLPGIGLLPM PVAPRQIPYH AGSTYFELDR GSAHWKQLTH       420
     SGGFAFHIAG QFPGLNLAFW AIRG                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page